DPCstruct | MC17226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 147 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9CY42 | 1-151 | MIAMHLEATYSGYNTWSEFASCLLRISRCEEDRASMCVDGDEADSKESYGATFSRIPDMFVRGISGKTWKLRCKWWLNRHFSKETLA… |
| A0A453R8I3 | 48-198 | YNTTRLLERIALHLDCVNGKPSIWEELVSCFLRLFSDRTTDYEDCISCNVEGDASIDAFSSLSSVFFEQHTRESWKLRCKWWMNRHF… |
| A0A078GFK9 | 158-315 | None |
| A0A0K9R1Z0 | 25-179 | None |
| A0A834XFR8 | 478-618 | None |
| A0A7J7CKC2 | 75-192 | None |
| A0A4D9AB78 | 621-763 | None |
| A0A2P5BVH2 | 486-632 | None |
| A0A804PZH1 | 220-374 | None |
| A0A1U8GZP9 | 398-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.