DPCstruct | MC17225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 96 ± 20 aa |
| Standard deviation of domain lengths | 19.77 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9S9E4 | 171-255 | VSEAARFTFIENQIRNNFQQRIRPANNTISLENKWGKLSFQIRTSGANGMFSEAVELERANGKKYYVTAVDQVKPKIALLKFVDK |
| A0A7J6FKM8 | 1-85 | MVAEAARSKYIQQKIEWKGFEAGFFPKSDIISYENKWKNLSKAIQNSKNGSFPKIQLQNEDYSVRYVSKVADVKNDMALLLNIAA |
| A0A7J7GW99 | 169-252 | None |
| B9SBQ1 | 186-268 | None |
| A0A6A3CB03 | 98-233 | None |
| A0A7J6DVN5 | 1-103 | None |
| A0A6A6LH17 | 41-125 | None |
| A0A803MDX7 | 136-216 | None |
| A0A6P5YLR9 | 4-120 | None |
| A0A6J1DYP1 | 189-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.