DPCstruct | MC1722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 112 ± 18 aa |
| Standard deviation of domain lengths | 18.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12069 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A442SJ71 | 1-110 | MSRHYLFPNEGEPLRMSLRLVEGLIFGKDTLPQYAGTRQRVLSATLEFDEAKKPTRILRTEPSVWVFDQDGGIRQGLHEALALAMDI… |
| A0A3E0JZQ0 | 1-72 | MGERTKYLCVAEEKIVEIPISKIKNGVMEKPELANQTLLMMQLVDETENRKPYKILHISFENVSFDENGKYD |
| A0A0F9EKD7 | 1-101 | None |
| A0A158D3T6 | 63-185 | None |
| A0A3D1QV73 | 163-285 | None |
| A0A3A4YW69 | 4-113 | None |
| A0A2V7IBZ4 | 3-131 | None |
| A0A4R3JWZ0 | 74-190 | None |
| A0A2D4S9Y3 | 59-162 | None |
| A0A090PA26 | 16-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.