DPCstruct | MC17213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 9.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A529NX42 | 22-105 | QFNDHDRRDELLLADLAAAARKKGLVLADGECYDFDTPPVLGGEMSAAQINKTFFVVKVHITGQIHRQVKDLPHGTKINKVTIG |
| A0A849NLP0 | 4-87 | LMRDPEFRKNWEMTNLVALAEAARGEQSESRCFCLKIPSVLGGEYSSDNIGTIDVHELISFAGDLGRQIKDLPDGTTIRLNVDA |
| A0A318ULU7 | 55-138 | None |
| A0A846WD35 | 217-304 | None |
| A0A532DJR5 | 127-237 | None |
| A0A3S1SAL0 | 1-75 | None |
| A0A2P1PPP3 | 7-90 | None |
| A0A525WMH1 | 149-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.