DPCstruct | MC17211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 305 ± 16 aa |
| Standard deviation of domain lengths | 16.27 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5MV67 | 1-327 | MKKTLFTYITAFLCSVIGGSFLLAAAYALPQRSIDKHVEESVAVLAEEGNYPVETPGILGTMRDNYTDAIMLNMASYDSKYPLLQKA… |
| A0A1H3DKY3 | 150-444 | AKSFFRSFAIIVANLVIGCILATGILYAVYLLPINKIDRNVGKSTLIFYQEGSYPELTGYATSTLDNWTDSVIVLEAASPRVESPIK… |
| A0A2T3FLQ7 | 3-271 | None |
| A0A518RD01 | 2-325 | None |
| A0A845R1K2 | 156-458 | None |
| A0A1I0UYQ8 | 1-303 | None |
| A0A3D2EET1 | 1-314 | None |
| A0A2S4M9H3 | 41-351 | None |
| R9IU72 | 7-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.