DPCstruct | MC1721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Standard deviation of domain lengths | 11.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D1D9P1 | 12-73 | ADDITEADARTALQQLDPLWDELFPAEQARIVALLVERVDISTDGLNVRLRVDGLSGLAREM |
| A0A442S1M9 | 2-64 | DDSSITETEVREALVQLDPLWDELFPPEQARIVQLLVEWVDVAVESISIRLRTEGMASLATEL |
| A0A1X7MLD4 | 75-143 | None |
| A0A517Y4E7 | 51-123 | None |
| A0A1M3PZ89 | 175-252 | None |
| A0A840V3Z8 | 316-383 | None |
| A0A3D3ZV92 | 17-124 | None |
| A0A1Y2K9Y3 | 8-77 | None |
| A0A2M7EUJ4 | 553-625 | None |
| A0A1V4XQX0 | 21-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.