DPCstruct | MC17209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 162 ± 7 aa |
| Standard deviation of domain lengths | 6.85 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6WPS5 | 280-445 | PDIAADWTQNLPNHDDVDGYHETSGTSFATPRTAGILSFVLEQLRHEVGDMGSGASTEDRNGMLVDGVWPEGHPNAGSEAGITNSIV… |
| A0A6V8CFX4 | 11-157 | LPNHDDTDGYHETSGTSFATPRTAGILSLVLMMLRADAEDNLTGASDVYNRSGLLVQGENISITNADIRHALNLSGWYPTFTTWDPT… |
| A0A363UJ26 | 90-259 | None |
| A0A2N5KC30 | 726-890 | None |
| A0A1Y1SFW9 | 362-526 | None |
| A0A7M3ZVS6 | 1-168 | None |
| A0A7J4QLP5 | 84-242 | None |
| A0A838HUY2 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.