DPCstruct | MC17206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367FGB0 | 1-56 | MFFDARGQERVLRVTWHDGTLVLSLWRGEMCTASFRMPMEDVGRLLDTLDEGYADA |
| A0A4Y9NSV6 | 1-69 | MTTVVRLPVRGQWAWDVRGEGRAVRISTHVESGLVNLSVWRHDTCVGTVRLLPSEVANLMTGLSEGLAQ |
| A0A368VW84 | 42-111 | None |
| A0A7X0ICX5 | 1-72 | None |
| A0A7K3WIM3 | 2-85 | None |
| A0A3A5HBZ8 | 2-75 | None |
| A0A3N0DTL0 | 5-80 | None |
| A0A5Q2RHR0 | 3-77 | None |
| A0A7W7DAG1 | 6-75 | None |
| A0A1H5X7V5 | 6-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.