DPCstruct | MC17204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 853 |
|---|---|
| Mean domain length (aa) | 82 ± 15 aa |
| Standard deviation of domain lengths | 14.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.43 |
| Pfam Score | 99.14 |
| Assigned Pfam label(s) | CL0063- PF11409- PF11979- PF09311- PF12767 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7FVT9 | 549-617 | PPKMVSFQESAKCFHCRKLFAVFKRACHCRNCGVCICASCSISWPAKMLPETYNLKNEASLKVCTSCDT |
| A0A7J7RPU4 | 47-138 | RFNGDFGDEVMTRWLPDHLAAHCYACDSAFWLASRKHHCRDTDRVDETWNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHP… |
| A0A6S7GT17 | 117-218 | None |
| A0A7S1XPX9 | 500-579 | None |
| A0A6D2I6Z2 | 25-116 | None |
| A0A7S0M9Q5 | 31-104 | None |
| A0A7S4A238 | 716-790 | None |
| F4PPW8 | 2-74 | None |
| F4PZL5 | 388-467 | None |
| A0A1B0BS54 | 2-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.