DPCstruct | MC17203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 77 ± 19 aa |
| Standard deviation of domain lengths | 18.68 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 72.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.66 |
| Pfam Score | 96.07 |
| Assigned Pfam label(s) | CL0229- PF02008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4INH6 | 9-71 | TSSAAPNPSSPLGASKRMRSARCGVCAACNADDCGECKNCVDKPKFGGPGNRKQACTMRTCIQ |
| A0A7J7RPJ5 | 21-92 | AVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCI |
| A0A3S2U960 | 44-108 | None |
| A0A443RC08 | 176-317 | None |
| A0A3M0LIV7 | 264-356 | None |
| A0A1X7SRY8 | 193-267 | None |
| R1CV33 | 87-155 | None |
| A0A2K5MJY9 | 10-80 | None |
| A0A2I4CWN5 | 248-315 | None |
| A0A397EU90 | 356-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.