DPCstruct | MC17200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2S8Q0 | 58-152 | HFDIGFYYANWGSIDAYIKLPAGTIPDALLGFSRDGLHVHQSDEWQLLIFSIKEYYEYFDDEDADDFFHHLAGLRSALIQGDWRLVY… |
| A0A6L3AJS4 | 55-165 | MRDYFDAMLYMANWGARRLMFRITQTLIDMKKVGRYCISDEINKVVAKEYVILDLNFHDEELAEWTEGEGWLDELVGLREELLQGDF… |
| A0A0M8XZC9 | 47-139 | None |
| A0A150QSE4 | 36-137 | None |
| A0A229SFP7 | 32-125 | None |
| A0A439IWW9 | 1-94 | None |
| A0A4R3V2R1 | 55-168 | None |
| A0A7X6Z8U4 | 1-105 | None |
| A0A3N1T924 | 290-382 | None |
| D0LS18 | 181-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.