DPCstruct | MC1720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 185 ± 26 aa |
| Standard deviation of domain lengths | 25.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2BHH9 | 28-211 | MDIDSIALRLGPFKKGQKLIVESQYPMDPRLMLRSRDNDVYFVYGYIQASIMLLNIVHYGKSYFRKDSYIYPAMFCFRMYLELTMKL… |
| C3J9L2 | 29-220 | GEDAYAFETISDAYFECAKMLLDKMQSKSQSPSVVDGLIYPLFFNYRHSIEIYLKALFFRYGEQTVEARREFLGLGHDLGQLWAKLR… |
| A0A0W8F8M6 | 19-257 | None |
| A0A4Y6KRR4 | 2-157 | None |
| A0A7V7SAG2 | 7-163 | None |
| A0A2G8SZR5 | 17-192 | None |
| A0A1T5KYP6 | 2-154 | None |
| A0A3S0E3J7 | 2-150 | None |
| K0XJV3 | 55-214 | None |
| A0A3G8LSG9 | 23-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.