DPCstruct | MC172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 13 aa |
| Standard deviation of domain lengths | 12.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1E7P6 | 2-74 | AERFANGAVIKTNHLTDEFDFKAFQGMYGKDATPLFLIDGGTELTVISPDRSIHPLPGQQLISLVDPVDERLQ |
| A0A1Q6DIH6 | 62-133 | ITFSDLAANLTKGWKIHNTPLTEQFTYEKLIEKYESRLIPLFAVQPNGNLEIFTTDHKIKPRPGWTLIAMMP |
| A0A6M1HX84 | 1-88 | None |
| A0A2T2U7A7 | 147-237 | None |
| M5R9G5 | 7-97 | None |
| A0A2A2M5U4 | 1-77 | None |
| A0A125QJB7 | 42-117 | None |
| A0A3C1QW89 | 11-86 | None |
| A0A517P3V0 | 608-718 | None |
| A0A3C1NW71 | 153-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.