DPCstruct | MC17199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 154 ± 14 aa |
| Standard deviation of domain lengths | 13.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5TJ24 | 120-273 | DESQTRTYIPEPQRSSNRNWTDKPAGREASYRRNRRNTQGTRGRQLQRLRSERVERTFAHLCGTGGARRTWLRGIEEVRKRYMSAAM… |
| A0A2A2Q8K9 | 1-185 | MKATSRWRKPAAFRWSGCGSSLAIPMNPNASRTSRTPFVRQVLHKAKRAVGSKSGKALLRKRGEHLERSFCHVLDHGKHRRARLRGR… |
| A0A517YA99 | 1-147 | None |
| A0A6N8VE76 | 2-153 | None |
| A0A7C1PFM0 | 105-254 | None |
| A0A660VF50 | 85-238 | None |
| A0A2V9XEH3 | 6-142 | None |
| A0A523A6Y3 | 2-138 | None |
| A0A3M1GDX7 | 252-410 | None |
| A0A849ZZS1 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.