DPCstruct | MC17198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 247 |
|---|---|
| Mean domain length (aa) | 227 ± 36 aa |
| Standard deviation of domain lengths | 35.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.26 |
| Pfam Score | 93.94 |
| Assigned Pfam label(s) | PF01124- CL0172- CL0292- CL0342 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482ZKS7 | 2-196 | DIGVLYKVTIFWVIFYITPGPVWVSVMEATRKLSFTGIWQFFIRVFLPVNASVQFLQALICAIFVEFVATIFSQIGLLFYILGGSYI… |
| A0A662PL49 | 77-320 | DELVEEDGAYGSEGSDGMGCLSFLAITVAALVDSINPCSMAILFFLLAGLLLLRKRKKALRVGLAFTLSVFVANLLFGFGILSAVVL… |
| A0A171JVJ2 | 14-211 | None |
| A0A1G2VLK1 | 4-231 | None |
| A0A2E2YND2 | 1-244 | None |
| B9XS93 | 1-221 | None |
| A0A1W1B8S5 | 1-251 | None |
| A0A656HKX2 | 94-292 | None |
| A0A0G1H343 | 1-241 | None |
| A0A6V8ENU0 | 81-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.