DPCstruct | MC17195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1MSY7 | 3-106 | FESREDAGIKLAEKLEKFRGESVVVLALPRGGVVLGYEIAKHLGAPLDLIITRKIGHPTSPEYAICAVAEDGHMLCNEEERSRIDKE… |
| A0A533WU67 | 65-165 | FRDRVDAGNLLADRLAKTEHRPAIVLGIPRGGIIVANIVARKLGTDFDIVIPRKLGAPENEELAIGAVMEDGTSYINSYMVNALRVP… |
| A0A370HPD1 | 1-85 | None |
| A0A534WB78 | 3-77 | None |
| A0A6L5EYD1 | 9-94 | None |
| A0A2H0PR88 | 1-83 | None |
| A0A4P7BCX8 | 2-96 | None |
| A0A256ZG43 | 23-124 | None |
| A0A3A3FKQ3 | 24-138 | None |
| A0A1W1EKS6 | 8-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.