DPCstruct | MC17192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18995 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7DVM6 | 91-188 | TLIKPSQNYCEIFLRSCFRQCRLCDRKSTHQYLCLLCGRLLNLDRICYDISKCLSFHANECGNSAACYLSISNRLILIVLGQLGAFW… |
| A0A421EYA9 | 2-99 | DLFIRYNEKPAGVCYQCAQVPQHPGLCLFCGEVLCCFSACCEAKEGGGVGECTRHAQRCGLGLGAFLLLRACTVILFLGNERRCVWG… |
| A0A7S2SNG9 | 395-496 | None |
| A0A395IHH0 | 1075-1178 | None |
| A0A0C2J3L5 | 1-121 | None |
| A0A453DYU6 | 414-512 | None |
| A0A7S4PCZ9 | 69-175 | None |
| A0A6V7SZT1 | 27-134 | None |
| A0A0R3U582 | 920-1029 | None |
| A0A7S1P3C6 | 26-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.