DPCstruct | MC1719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 231 ± 34 aa |
| Standard deviation of domain lengths | 33.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7YNB9 | 150-395 | QKQRKIIRRMAVVPALPRDLKGWVHREVLPAYLFYNYHKGKGPMKGYCTFCRHEVEVTGAKHNQKGSCPRCKKEVMFKSRGRRGYIH… |
| A0A8B2BGT5 | 149-374 | EKAVLAESKHLLPITKQQSKWAFRECIDHFAYRLPKGRTTCMDCGHSWIMNKHRETCTCPHCRAKLQVKETYERKLQQKQYFTLLTT… |
| A0A1M3KW23 | 3-263 | None |
| A0A7J0BBV8 | 2-216 | None |
| A0A413KZ43 | 143-418 | None |
| R6LCD8 | 6-246 | None |
| A0A0U1KW46 | 12-273 | None |
| U2U5Y4 | 4-233 | None |
| A0A1Y4RSJ9 | 168-414 | None |
| A0A3A6IXK5 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.