DPCstruct | MC17189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 160 ± 14 aa |
| Standard deviation of domain lengths | 13.78 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7K7C8 | 1-169 | MQPNGSPDCVEGFSLPDVELASKVEAYLAGIEVTDHNPAILFSWDNEALEEFVQAANSEADGHPLWFSQPRGSVSPSSITSDIIGYL… |
| A0A3R7WRH3 | 15-161 | SDAVLASKIEAYLTGITVTDHKPAILFAWDSEALEEFVQAANAEADGHPQWFSEPQGNISPQSVMTDIITYLAQLGGGRCDHVLLAP… |
| A0A1V9YTZ1 | 1-151 | None |
| A0A485KAC9 | 13-173 | None |
| A0A662WVA7 | 4-158 | None |
| D0N7H1 | 179-333 | None |
| K3X2D3 | 5-148 | None |
| A0A067C1N2 | 48-210 | None |
| A0A662X9K2 | 41-228 | None |
| W2KZL9 | 31-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.