DPCstruct | MC17188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1343 |
|---|---|
| Mean domain length (aa) | 338 ± 78 aa |
| Standard deviation of domain lengths | 78.13 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.78 |
| Pfam Score | 78.39 |
| Assigned Pfam label(s) | PF08412- PF02888- PF11933- PF03520- CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6EB93 | 9-239 | WYRAWTKFILLWAVYSSFFTPMEFGFFRGLNEDLFVLDIVGQIAFLVDIVVLFFVSYRDSHTYRMVYKRTPIALRYLKSSFVIDLLC… |
| A0A3R7GHM5 | 29-386 | IKEGSKETITRQNTVTAQSEAQSQPTDSDETEGGYLLAAWNFFEDPQSSAPAYYFSLSIYGFIIISTFTFVVETEAVFDPYATALNH… |
| A0A0V0QJB2 | 6-215 | None |
| A0A0V0QB80 | 442-750 | None |
| A0A6I8NV72 | 333-658 | None |
| A0A5S5CUZ8 | 31-313 | None |
| A0A7M5X3M3 | 11-318 | None |
| A0A7M5X154 | 6-311 | None |
| A0A813ACJ3 | 13-433 | None |
| A0A182TP78 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.