DPCstruct | MC17185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 77 ± 14 aa |
| Standard deviation of domain lengths | 14.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0042 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9QSV9 | 1-88 | MDILIVHAHHEPQSFSSALYRQAETTLKALGHTVETSDLYQMGFDPVSDRRNFTSVHDPEYLKQQLEERHASEVNGFASDIEAEMQKL |
| A0A1H0LPA1 | 1-70 | MKVLTVYAHHDPKSFCHAVLQRFTAGLQEAGHTNTVIDLYADDFDPVSRDRDVPSYTSGNMPEVSMTRSR |
| A0A7J6CTN0 | 217-307 | None |
| A0A6N6X6T8 | 7-75 | None |
| A0A6N6XC43 | 1-58 | None |
| A0A2E7V182 | 1-64 | None |
| A0A0A0ISB6 | 27-93 | None |
| A0A1H6APU0 | 2-78 | None |
| A0A0F7CGY5 | 1-85 | None |
| A0A1Z3LZ68 | 50-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.