DPCstruct | MC1718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3TU60 | 27-136 | TGFYWAVTKIPELLEAFRNGVQALKKSERPCVLAQDPARLTGSICLDAALRKQYPSDPRWDYGIGYNHLQDGEKVTWIEFHPASSHH… |
| A0A8B2AS46 | 7-111 | KKGGGGAENAKCAFQIAVENMPDVKNGFRAGLQAVKNSDRNKVNVTDPRKLQGSLDIDTQVQKKYPQEPRWDYALSYDDKLYFFEVH… |
| A0A2M7CE69 | 4-104 | None |
| A0A7X3VMX3 | 2-106 | None |
| A0A5C8C225 | 1-122 | None |
| D0LLV0 | 5-88 | None |
| A0A2W5TE80 | 15-102 | None |
| A0A7Y5CSK7 | 46-127 | None |
| A0A7Y2P033 | 4-121 | None |
| A0A7V6E8M0 | 3-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.