DPCstruct | MC17174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 131 ± 24 aa |
| Standard deviation of domain lengths | 23.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2LU40 | 86-255 | ADQYDFDAAKGAGIEHFEEMVSNHQDGAYADEEGLRRVAVDLAAQRSHNGAAGRRPHAVQPWYRVRAKTRELRATRPRDELVEALFH… |
| A0A7S4SRB9 | 206-321 | SAAAAERAARPWWVGLSREELCAEVHHRMDADRDGRLLSGELRSLAESLGWEGGDEEWEELYQVACNVCGSRPEVGFDAAQLHTFID… |
| A0A813GYX5 | 100-213 | None |
| A0A812RKS9 | 751-912 | None |
| A0A812TS21 | 814-945 | None |
| A0A1Q9E474 | 895-1015 | None |
| A0A7S0AIH8 | 20-139 | None |
| A0A812P2N9 | 16-171 | None |
| A0A1Q9CIK5 | 8-123 | None |
| A0A812JA37 | 45-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.