DPCstruct | MC17171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 160 ± 20 aa |
| Standard deviation of domain lengths | 20.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0H9T9 | 11-154 | PVGRWFRSIVAVRLAGEGIRTPGELVTLVNRRGGQWWRSVPRIDAGRARVLVAWLRRHAASIGAVVEPNVDAGDALAPTTTRITTGA… |
| W7W179 | 198-399 | SVAAWLNPTLASHLEAADIFTLAQLVERINGVGRRWHAGIKAMGEGKALRIVEWLREHQDSIELQLGRHVAMPRSKLYAHELNAVVL… |
| A0A228HMJ0 | 101-242 | None |
| A0A4Q3MJX5 | 140-324 | None |
| A0A5C6TN37 | 1-170 | None |
| A0A2W5S019 | 167-327 | None |
| A0A2I8F5H2 | 38-183 | None |
| A0A6J5FD83 | 94-229 | None |
| A0A2L0X2N5 | 167-361 | None |
| A0A158KNM9 | 18-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.