DPCstruct | MC17170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 5.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G3H2L1 | 45-127 | APYWPWGPRINPEQLATILRELLTAVDELAKLEHWRDSDYDHVVMCIERQPISTLLPDLGYFRDRLQIARAEVQAQHAATARS |
| A0A0D0GY30 | 1-88 | MSEHASGGFRLAWGAWLSTDDIYRMRWELAGLIDQLADEERWSFDRRARVMCNAARGPISDLMPSLNFYRERMAEVFAERDARRLVAS |
| A0A158DQH1 | 61-152 | None |
| A0A4R0XGF8 | 8-87 | None |
| A0A848IHD8 | 52-138 | None |
| A0A0F5JYS4 | 1-72 | None |
| A0A4P7CP20 | 89-175 | None |
| A0A5B0HJ17 | 68-149 | None |
| A0A7W8S3Z0 | 25-103 | None |
| A0A5E4UQ06 | 23-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.