DPCstruct | MC17169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 9.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P1H177 | 18-94 | LTDKMSQNTKPKGTLGEIIELIRELFSSTWSIYENGSPTVKKTILKTAFKAPLAYDRENGYRAAQVSLIFDFYRILH |
| Q168Y4 | 1-78 | MVDKMDQKAQPKHTLEEIFELSMAFLANPWIIWKNGDLTLKKTVLRLVFDKPLAYSKKTGFRTPQTSVIFRFLDDLTE |
| A0A4P7JEQ0 | 10-103 | None |
| A0A238KDT4 | 7-92 | None |
| A0A640W0X8 | 1-94 | None |
| A4F153 | 1-84 | None |
| A0A1B1UK57 | 9-107 | None |
| A0A2A4ZMW2 | 8-100 | None |
| A0A545SMK1 | 63-146 | None |
| A0A2G2BAK8 | 19-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.