DPCstruct | MC17167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 173 ± 20 aa |
| Standard deviation of domain lengths | 19.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522D526 | 4-176 | RKKYVVDKKFQLKTVFSILGMIVFAGVLIMTAIGVTIAFNNERLNNVIVIHSNVVDALITYAQDAPAAGDNPAIKNASKIHAQNIDT… |
| A0A2N1PRM1 | 43-207 | GKAFKRRIMIINRDFQYKFISMILLLVILNALIITWNIYSMSTSVLAKVIGPQTAAEIMPAIHSTLFRDHWLTMLFLLGVTIAIVTF… |
| A0A831NRY8 | 28-197 | None |
| A0A523DSP2 | 3-149 | None |
| A0A3M1SF34 | 2-167 | None |
| A0A2N6CG37 | 1-194 | None |
| A0A3D3GKY4 | 40-243 | None |
| A0A1F8ZJC7 | 2-160 | None |
| A0A562S7P8 | 25-187 | None |
| A0A3C0TML5 | 3-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.