DPCstruct | MC17163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 179 ± 34 aa |
| Standard deviation of domain lengths | 34.20 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04085 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212KD94 | 31-221 | REEANRAEQYLASVREDLAELARLRSLMGVTPPDNWHSLGTRVLAGRFGPGSSLETVMIDRGFATGAAVGTPLVTHQGLVGRVFRAS… |
| A0A2H6INZ0 | 1-121 | MVAVTPLGPVGKIHRIFDDGASIILLTDVNSSVAVRLQSTRVVGILEGRGDGTCSLKYVSKRVEVKVGEQVVTSGLDGIFPDGLFVG… |
| A0A655W1P2 | 7-161 | None |
| X1QDC6 | 6-177 | None |
| A0A0B8PIQ6 | 20-209 | None |
| M6JE77 | 61-305 | None |
| A0A2R7S457 | 10-240 | None |
| A0A356IXV7 | 60-261 | None |
| R5VFI4 | 27-188 | None |
| D4KBY6 | 21-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.