DPCstruct | MC17162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 154 ± 25 aa |
| Standard deviation of domain lengths | 24.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 94.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0087 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4GKJ4 | 75-222 | VAWRNMFWALSDSMCSEATPWVNGAYLPDHAALQTYRVMAPMAYAKIKNIIERNVTSGLIYLPSSARDLNNPQIDKYLAKYVRGSNG… |
| A0A212JB82 | 2-146 | IHRAETLYACCLAASYEGHKEASGNFFINSVMANASKMHEAKELNEAIRLLIDICGGFVADMPSDKDFSNAEVGPLLKKYMKGASGV… |
| A0A5C8M2Q7 | 227-416 | None |
| A0A1W4UMA5 | 97-247 | None |
| A0A7W1L576 | 209-372 | None |
| A0A7W1L7T8 | 8-133 | None |
| A0A7W0GN50 | 101-274 | None |
| A0A644Y819 | 2-134 | None |
| A0A2V7EEN0 | 201-364 | None |
| X1Q5C7 | 12-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.