DPCstruct | MC17161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 319 ± 59 aa |
| Standard deviation of domain lengths | 59.14 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.35 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF01514- PF08345 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090SE51 | 2-278 | ENARYRHGLEGELVRTIISLNAISNARVHLAIPRQTLFVRQQGEDPSASVMIELKPGEDLKPDQVEAIINLVVGSVTGMKSEFVSVI… |
| A0A212IXE9 | 21-397 | HLVLPARTLFIEEQQKPSASVVLKLSGAAKMDQRDVMSIVNLLTMSVEGLDKSRISIADTSGKVLFQPNEEGALQLSGTQVEMTNAA… |
| A0A7V6XKM4 | 2-252 | None |
| A0A2M7G3J0 | 21-245 | None |
| A0A7C0VLC2 | 68-442 | None |
| A0A258NC86 | 2-402 | None |
| A0A1A9X6M4 | 80-447 | None |
| A0A1B0C4W0 | 430-752 | None |
| A0A514BRZ6 | 34-323 | None |
| A0A6I6IGS8 | 346-755 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.