DPCstruct | MC17160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 430 ± 46 aa |
| Standard deviation of domain lengths | 46.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 25.87 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF12879- CL0474 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3DVU0 | 23-483 | GSSNDDFWTKDLEGLWKELSDAMMGQDGTTAGVDDCDNVSDGSNGTRKTTPSEKAACNYLHAGFTKLYDAAATAKPSSPSSVLNNPS… |
| A0A1B1E2I2 | 169-616 | CNRVQCVWKKWFPNRGMQETNTTYIGIFWDKDVNNQLKNLSGGMLKQKPDVDKECNSIPGLDNRNKEACKLIIAGLKHIYEIERGTL… |
| A0A1A7VVD9 | 4-427 | None |
| A0A6H5FTD1 | 1-375 | None |
| A0A6H5FTW4 | 77-418 | None |
| A0A6H5FTZ9 | 28-414 | None |
| A0A679KRX4 | 4-466 | None |
| A0A1A7W676 | 89-581 | None |
| A0A1A7VZL4 | 359-754 | None |
| A0A1A7VW79 | 26-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.