DPCstruct | MC1716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8CSX9 | 273-394 | NKNNTAQLVKWFSNFREFFYIQMEKYARQALSEGIKNSEDLHVTIESELYRVINLHYNRNNHIEVPGHFLPAIEVTLREFFNSISIG… |
| A0A815YWF1 | 28-143 | AQLVKWFSNFREFFYIQIEKYARQYLAEGIRNADDLIITNDSDLYRVLNLHYNRSNQIDVPASFRDVVQATLREFFHAIQQQKDLEP… |
| A0A368FHY4 | 59-165 | None |
| A0A3Q0IKT9 | 1127-1249 | None |
| A0A226ETK6 | 2-95 | None |
| A0A813MZJ9 | 671-779 | None |
| A0A2A3EJG6 | 1-100 | None |
| A0A183N067 | 27-132 | None |
| A0A1W7R9X0 | 723-844 | None |
| A0A177BCK3 | 210-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.