DPCstruct | MC17159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 9.76 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 55.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G1IP23 | 1-86 | MSLDPDTAREFHDETLPAEPAKTAHFCSMCGPKFCSMRITQDVRDFAAKHGLETEEDIEAMLAEGMAEKSREFAEHGNRVYLPITQ |
| A0A7V8WFB2 | 19-92 | DQFNLSLDPVTAREYHDATLPAEGAKLAHFCSMCGPKFCSMELTQQVRQMAADGMDEKSREFREKGSAIYLRQD |
| A0A7C1TCX9 | 90-158 | None |
| W4QG28 | 169-248 | None |
| A0A1W1DKQ4 | 1-81 | None |
| A0A831ZGL1 | 47-128 | None |
| A0A800CXV0 | 299-378 | None |
| A0A4Y6UBA1 | 488-559 | None |
| A0A7G3A1G6 | 1-79 | None |
| A0A495AAS8 | 303-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.