DPCstruct | MC17158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 211 ± 43 aa |
| Standard deviation of domain lengths | 43.33 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.71 |
| Pfam Score | 82.42 |
| Assigned Pfam label(s) | PF02965- PF04071- PF02310 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5ZLF6 | 881-1121 | LDEVWAHLNRQMLLGKHLGLPGSWRRLLEAGDLRAVELAERVERLMDAAAARGWLAPAAVYRFFRAHSRGDSVIVLSPEGQELAALP… |
| A0A379X2R3 | 14-284 | VQEVEASIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGVEAQRLFKDANDMLDKLSAEKLLNPRGVVGLFPANRIGDDIEIYRDE… |
| A0A1V5VEW5 | 7-174 | None |
| A0A356FYV2 | 54-273 | None |
| A0A0D0S8Q9 | 2-197 | None |
| A0A7V9HGB3 | 7-204 | None |
| A0A353S935 | 12-200 | None |
| A0A1V6I902 | 63-280 | None |
| R1CGJ7 | 778-1102 | None |
| F0YY01 | 21-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.