DPCstruct | MC17157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 102 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 17.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150X934 | 16-117 | EPVNLVEEHFIHISMCKCCKRIGLHYTNLLCSFRILGFKSFASSIIRTNFNYNAVYFPDQTNRIIISTCHQDIQFCFTEPEFYDFQH… |
| A0A512AZ28 | 1-106 | MCEVKRLYQNNFGEISQCGCSARIQLNFGNFVLGLSETELEVLQGYSPPLYEQEKEAGRPTNERNIYLSPSVYHLMLAFSLEELAGL… |
| A0A3B0C4G0 | 29-150 | None |
| A0A380BP27 | 29-120 | None |
| A0A7V3X7I7 | 3-104 | None |
| A0A2T5JGV1 | 51-169 | None |
| A0A1J4RLY1 | 6-93 | None |
| A0A843T2B6 | 408-525 | None |
| A0A2S9WVZ4 | 2-95 | None |
| A0A497JGV4 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.