DPCstruct | MC17156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 15.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 45.30 |
| Pfam Score | 95.47 |
| Assigned Pfam label(s) | PF02772- PF02773- CL0063- CL0145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3XUA5 | 102-212 | AFSGKDYTKVDRSAAYAARWVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVSKNFDLRPGVIVRDLDLK… |
| A0A7K0R2Y5 | 169-301 | RHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAASLATRCEVQVAYAIGKAHPVGVFVETFGTGVLSDEAIQEAVLRVFDLRPAAIIR… |
| A0A7X4CTI1 | 133-248 | None |
| A0A377LT53 | 13-118 | None |
| A0A059AAK8 | 91-215 | None |
| A0A4X3PCZ2 | 104-192 | None |
| S9XAE6 | 288-421 | None |
| A0A6I1IP70 | 22-135 | None |
| A0A174JQL2 | 2-95 | None |
| T1B6E7 | 19-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.