DPCstruct | MC17153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 420 ± 75 aa |
| Standard deviation of domain lengths | 74.64 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0EFW9 | 63-573 | CKKVLISMYSDEEVHVACVECWNSDKWDQFQSAINYDFSQKFFDQWYSLLKKAPRIFAYRNGNLVNSDYTNYTVDNKNAYLSYSVVE… |
| A0A0G0C2B4 | 55-481 | KNIIALYPENTFVPVYSHDEWNSDDYILPYLNIDFSKSFFEQFHELQKIAPVIALLSNMQENAEFCQDSEGLKNCYTVFDSLNCRDV… |
| A0A0G1R2V9 | 644-1174 | None |
| A0A0G1GUA7 | 54-495 | None |
| A0A0F9EUX9 | 73-437 | None |
| A0A1F5EF88 | 2-405 | None |
| A0A554K3W3 | 4-430 | None |
| A0A1F6UUP6 | 24-411 | None |
| A0A1F6BWI6 | 9-430 | None |
| A0A2M7UR41 | 13-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.