DPCstruct | MC17151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 53.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A141RJP5 | 144-201 | PPLPPQENVWINKTGSTNGFGAYIAFVPAKKMGIVMLANKNYSIDQRVTVAYKILSSL |
| A0A2Z3GDF4 | 1-71 | MTRLDPPLPPRDDALINKTGSTNGFGAYAAFVPAEHIGIVILANRNYPIPARVKAAYQILTELQRAAASAP |
| U4T905 | 26-86 | None |
| A0A545YY99 | 58-111 | None |
| A0A447QVV1 | 170-229 | None |
| A0A7W6H8S5 | 14-71 | None |
| A0A2X1N4M7 | 34-96 | None |
| A0A828KDH2 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.