DPCstruct | MC17145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 265 ± 55 aa |
| Standard deviation of domain lengths | 54.74 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 70.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.45 |
| Pfam Score | 86.84 |
| Assigned Pfam label(s) | PF19252- PF03343 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A250XJM3 | 27-270 | IEETNRLRISLGLKPLNMEAPQKQSAVDVKKQEQARKEAEQERLAADLRARIEAHKSARQQQSFLAVKGLGEADEDDDMASWVERSR… |
| A0A0T6B9L9 | 98-353 | IDETNKLRAKLGLKPLELSTDERKSDGKKKDEWGEFYHKPAANLSEKKEQEKIKAKLSEHREKRQIMNKLVKTKTLGESDSEDDVST… |
| A0A7S3ZNY7 | 2-403 | None |
| A0A453DHS1 | 6-222 | None |
| A0A6I9YMW1 | 2-196 | None |
| B5VSI6 | 2-209 | None |
| A0A0M3IKG4 | 2-244 | None |
| A0A061F9H8 | 120-377 | None |
| A0A4Y7IKL1 | 69-270 | None |
| A0A6J2K301 | 16-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.