DPCstruct | MC17144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 176 ± 36 aa |
| Standard deviation of domain lengths | 36.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.52 |
| Pfam Score | 84.88 |
| Assigned Pfam label(s) | CL0039- CL0740- CL0350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C1E9B0 | 5-149 | QKGNFENVKGDVVGQHDGVAYYTIGQRKGLGIGGQGDAWFVVGKDVERNVVVIDQGTHHPALYASTLTATDLHWHSPELPKTPFTCR… |
| A0A250XEE4 | 252-462 | LNKTQVRQLANIADLANKNRKDSQGICFLGKVKFHEFVHEHLGEWPGLLVEEETGTVIGSHAGYWFYTVGQRSGIKLPGGPWYVVRK… |
| Q7NBZ0 | 458-645 | None |
| A0A6P6I351 | 38-199 | None |
| A0A7S1Y129 | 284-503 | None |
| A0A099P744 | 218-407 | None |
| A0A2I0NC84 | 1-114 | None |
| A0A812P1I4 | 181-360 | None |
| A0A7R9Q653 | 105-320 | None |
| A0A1B0C713 | 136-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.