DPCstruct | MC1714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 3.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 73.50 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | PF02138- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9Y385 | 30-98 | VMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNT |
| A0A815X6F0 | 1-71 | SVMFAFIDRSIVKKVVNFLPRVGVGSRYGLPQQRRTSLPSAKQLFRSANMTQRRKRRETSNFEYLMYLNKI |
| A0A3P7PLL8 | 41-109 | None |
| M7BV09 | 70-134 | None |
| A0A3M7S4E8 | 48-116 | None |
| A0A820JSI1 | 1-68 | None |
| A0A7T8GUU6 | 1-64 | None |
| A0A4Z2JCS3 | 30-98 | None |
| A0A3P9IDY9 | 30-98 | None |
| A0A0C2FSU2 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.