DPCstruct | MC17137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 218 ± 31 aa |
| Standard deviation of domain lengths | 30.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7QTG3 | 2-211 | MLRDPTGLAIWCKRLAWLWLATEGILALSCIGEIYILGGLGSPPGTAEAIEDAADISALASLPYMLAYIVCGILVARWIHRINRNAH… |
| A0A0M1JLD5 | 4-190 | LIGINIISLISNLLQMDLLASGYISEGAAEINDNRQLFIGITFSIVYIITGIMFLRWVHLLNKNCHGFGTQDMKFTPGWAIGYYFVP… |
| A0A810LPW7 | 152-353 | None |
| A0A1V5UZG5 | 37-262 | None |
| A0A534ZXE3 | 4-212 | None |
| A0A6B2TZ57 | 13-299 | None |
| A0A4R6KR65 | 16-264 | None |
| A0A842Z5J0 | 115-351 | None |
| A0A5R8P9H6 | 10-255 | None |
| A0A2D6GPV8 | 76-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.