DPCstruct | MC17136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 166 ± 31 aa |
| Standard deviation of domain lengths | 31.02 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01618 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9X3M0 | 6-157 | MPLIVAVVVAVFMSILAVKDYRSFKRGQHVDYKSMIVSLGILGTFSGIILGLWDFDSENISESVPKLLDGLKLAFFTSIFGMALSVL… |
| A0A0M1JER3 | 3-148 | LDMILEAMQADPLLTIFINIMLILVIIDTATFFSSRIQHFDCKGLLTSLGLLGTFLGIALGLKAFNPQDIQASMPAFLHKLKFAFLT… |
| A0A447QNJ6 | 15-220 | None |
| A0A483AH98 | 4-101 | None |
| S2KIQ4 | 2-185 | None |
| A0A3D8J0F5 | 3-176 | None |
| A0A450SSS9 | 39-213 | None |
| A0A355B0F8 | 3-143 | None |
| A0A077DCU7 | 10-185 | None |
| A0A2U8FBQ2 | 2-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.