DPCstruct | MC17134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 90 ± 14 aa |
| Standard deviation of domain lengths | 14.14 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00681 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0HU46 | 197-278 | LEGTSCIAGVYVESSKDRLSIYQAMKKNMIRPGTAFELLEAQAATGYVIDPIKNLKLNVTEAVKMGVVGPEFKDKLHSAERA |
| A0A1S3QY14 | 2-77 | IAGVYVQSTKQTMSIYEAKSKGLLTPGTSLVLLEAQAATGFVIDPVKNKKLSVEEAAAQGVVGNEWKNKLLSAERA |
| A0A2I0T2S1 | 41-120 | None |
| A0A7J5XF79 | 261-341 | None |
| A0A3B3ZBF2 | 214-303 | None |
| A0A662YYE2 | 425-506 | None |
| H2ZEP8 | 93-198 | None |
| A0A6J1VW21 | 3-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.