DPCstruct | MC17133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 185 ± 25 aa |
| Standard deviation of domain lengths | 24.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 23.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4JPM0 | 2-162 | DTLRNRTVEELRELQENAEEIERLALESQEVQELQLEREMALASNRSLAEQNLKFQAPLETGRTDLSSKYEELQQLAERCKEQKAKL… |
| A0A3S2PK28 | 3-174 | MSYMVCLTRSSLNQLSDMSENEDVLLEFFVRLPQFKQVTSDKEELISSIVDMAKKNLQMEPQLEDKRQEMLNKYEQLIQMKSAFETK… |
| A0A0E0GPV7 | 129-330 | None |
| A0A833VSY9 | 37-224 | None |
| A0A0X3P4M7 | 9-178 | None |
| A0A674H2Q4 | 14-217 | None |
| A0A482X132 | 7-171 | None |
| A0A816YL91 | 8-188 | None |
| A0A369JBR7 | 1-203 | None |
| A0A0K0EEB8 | 13-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.