DPCstruct | MC17130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 108 ± 17 aa |
| Standard deviation of domain lengths | 17.00 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060WV05 | 156-242 | DLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW |
| A0A3S2N9H6 | 4-106 | PGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDWR… |
| A0A016TRT1 | 177-263 | None |
| A0A5A7VAL0 | 133-225 | None |
| Q68TI8 | 357-481 | None |
| A0A7J6UAU7 | 322-464 | None |
| A0A2H2JLR4 | 159-271 | None |
| A0A182GD92 | 210-311 | None |
| A0A453KDL8 | 106-209 | None |
| W2T6I9 | 208-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.