DPCstruct | MC1713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 64 ± 8 aa |
| Standard deviation of domain lengths | 7.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D7ZWH9 | 89-156 | AKVNTVQIDGINFIENLSFDAFHEGIRLQSSVYQAQSLTHTKTKAIAADNIYVTNANRSYCTKNNIQI |
| A0A1Q6LZD0 | 97-159 | ISFEAYNESTCLTEAVERFKERTGYYPNRVLANQIYRTRANRNYCKEHGIRLSGPKLGRPGVN |
| A0A353RJQ0 | 90-151 | None |
| A0A6P0I5S0 | 2-58 | None |
| A0A2N2ZP08 | 48-115 | None |
| A0A356BWR6 | 37-109 | None |
| A0A7C1KWU8 | 1-43 | None |
| A0A2G6NBW4 | 12-70 | None |
| A0A847BP84 | 1-63 | None |
| A0A345C0Q4 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.