DPCstruct | MC17129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 14.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 44.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484CLU8 | 1-95 | MKCVPSASDLAQRIKPGEWTAIYSKDIKGLPRQEDGNACGIFMLMYALYIVLGADFDFTTGDMDTIRKWWCLLLLSGHSVVRFAQKR… |
| A0A3S2MBK8 | 8-106 | FNGQWTTKFGSDIKGFPDQTSGNSCGIFILMYALCMSTDLPFLFTEKEMAQIRKWWCVSLMERHGQRFAYWTNEAKVLLQGSLQPIY… |
| A0A1A8LH12 | 9-123 | None |
| A0A437DFY7 | 3-127 | None |
| A0A437BYE5 | 14-126 | None |
| A0A6P6RL20 | 110-213 | None |
| A0A1A8L3P1 | 557-686 | None |
| A0A6P8VAK9 | 77-178 | None |
| A0A6P8WK24 | 4-120 | None |
| A0A3S2Q3K9 | 77-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.