DPCstruct | MC17128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 135 ± 10 aa |
| Standard deviation of domain lengths | 9.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S2M6G6 | 1-135 | MADRQKEKLEYLSDGAVFRRNAFILIEEMVKLNNQTQQDTSMLVEEVLHSLFFLGVINCPPFSPRSLLDDDDVILAYLKREYPLPFQ… |
| A0A401NT64 | 127-246 | QNFVVSGYRFLDKVRLFIANSVREHKLAPEKGRTCFKEILHTILFCGSINDPIIEPKSFFGKEEEFDQLFAKYPDVFQKYNTELPTR… |
| A0A5N5JIP9 | 24-149 | None |
| A0A437D259 | 2-144 | None |
| A0A2I4D8K4 | 3-144 | None |
| A0A401S129 | 111-245 | None |
| A0A5N5J6U3 | 1-134 | None |
| A0A4D9EBX3 | 75-212 | None |
| A0A4U5VKT3 | 188-306 | None |
| A0A2D0S2G4 | 47-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.