DPCstruct | MC17127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 134 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7TGX5 | 15-153 | TVTIGQDFDESLQRACEVMGDHYKKREHRKSVEGDKCELKFKVATRDDEDARQFCELNAPWRLIKVERTQDADRHFTICHVEATLMC… |
| A0A016V3C8 | 3-165 | KELGMAFIKMQRITFFGLVLFSAVVSADRDPTFHRFCNNPPNFGEGKIVEGDKNRCQLTYNIATVDDTTAYNFCDTQQPFTLLSARR… |
| A0A0B1TJ11 | 21-138 | None |
| A0A016WIL1 | 12-159 | None |
| A0A016WH22 | 12-159 | None |
| A0A016W8L7 | 1-142 | None |
| A0A016UUA8 | 45-176 | None |
| A0A016UHB3 | 61-174 | None |
| A0A016UPF4 | 109-257 | None |
| A0A016RTJ7 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.